Recombinant Human SPOP

E3 Ligases

Product Code: TE3-111
Verified Applications: Suitable for studies of SPOP-mediated substrate recognition, CUL3 E3 ubiquitin ligase complex assembly, and ubiquitin-dependent protein degradation pathways.
Activity: Verified in Ubiquitylation Assay with CUL3/RBX1 and BRD4-BD1+BD2.
Purity: 90 %
Concentration: 30 μM

For Research Use Only (RUO)

Add to Quote

Need special pricing?

Note: To maintain product quality, larger quantities may be packaged as multiple smaller aliquots. The 1 mg size is generally supplied in a single vial.

Predicted Molecular Weight: 50 kDa
Tag: N-6xHis-SUMO

Background and Additional Info

Background: Speckle-type POZ protein (SPOP) is a substrate adaptor for the CUL3-RBX1 E3 ubiquitin ligase complex, where it mediates selective recognition and ubiquitylation of target proteins. SPOP contains an N-terminal MATH domain responsible for substrate binding and a BTB/POZ domain that facilitates dimerization and interaction with CUL3, enabling efficient assembly of active ligase complexes. SPOP plays a central role in maintaining cellular proteostasis through the regulation of substrates involved in transcription, signal transduction, and protein turnover. Dysregulation or mutation of SPOP has been implicated in multiple cancers, highlighting its importance in disease biology and targeted protein degradation research. This recombinant SPOP protein contains N- and C-terminal truncations designed to improve solubility and stability while preserving the functional domains required for substrate recognition and CUL3-based ligase complex assembly. The protein is suitable for in vitro ubiquitylation assays, substrate identification, and mechanistic studies of CUL3-based ligase activity.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Frozen Dry Ice
Alternate Names: HIB homolog 1; Roadkill homolog 1
Protein Sequence: MHHHHHHGSMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASA