2 μg SMARCA2-BD Isoform 2 run on 4-12% SDS-PAGE gel under reducing conditions, then visualized with Colloidal Coomassie Blue Stain.

Recombinant Human SMARCA2 Bromodomain (Isoform 2)

Accessory Proteins

Product Code: TAP-133

Verified Applications: Recombinant SMARCA2-BD Isoform 2 has been functionally validated for use in in vitro biochemical binding assays, small-molecule inhibitor characterization, biophysical interaction studies (including SPR and ITC), structural biology, assay development, and targeted protein degradation research.

Activity: Verified in Ternary Complex Assay.

Purity: 95 %

Concentration: 50 μM

For Research Use Only (RUO)

Quantity

Clear

Add to Quote

Need special pricing?

Academic Discount Bulk Request

Note: To maintain product quality, larger quantities may be packaged as multiple smaller aliquots. The 1 mg size is generally supplied in a single vial.

Predicted Molecular Weight: 14 kDa

Tag: Untagged

Background and Additional Info

Background: SMARCA2 bromodomain (BD) is the catalytic ATPase subunit of the SWI/SNF (BAF) chromatin remodeling complex, where it regulates chromatin accessibility and transcription through ATP-dependent nucleosome repositioning. Isoform 2 of the bromodomain recognizes acetylated lysine residues on histone tails, directing recruitment of the remodeling complex to chromatin and contributing to the regulation of gene expression. SMARCA2 bromodomain has emerged as an important target for epigenetic therapeutics, including bromodomain inhibitors and targeted protein degraders that exploit synthetic lethal interactions in SMARCA4-deficient cancers. Recombinant SMARCA2 bromodomain isoform 2 is supplied untagged and is well suited for biochemical and biophysical binding studies, inhibitor and degrader characterization, structural biology, and assay development.

Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.

Storage and Stability: Frozen Dry Ice

Download the Datasheet

Alternate Names: BAF190B, BRM, SNF2A, SNF2L2

Protein Sequence: MAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE