Active, Recombinant Human CHIP

E3 Ligases

Product Code: TE3-116
Verified Applications: Enables ubiquitination assays and protein quality control studies by targeting chaperone-bound substrates such as Hsp70 client proteins for proteasomal degradation, with applications in neurodegeneration and stress response research.
Activity: Verified in Ubiquitylation Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote

Need special pricing?

Note: To maintain product quality, larger quantities may be packaged as multiple smaller aliquots. The 1 mg size is generally supplied in a single vial.

UniProt #: Q9UNE7
Predicted Molecular Weight: 37 kDa
Tag: N-8xHis-3C

Background and Additional Info

Background: CHIP, encoded by the STUB1 gene, is a U-box–containing E3 ubiquitin ligase that also functions as a co-chaperone for heat shock proteins such as Hsp70 and Hsc70. It promotes ubiquitin-mediated degradation of misfolded or damaged proteins, linking chaperone activity to proteasomal protein quality control. CHIP binds chaperones through tetratricopeptide repeat domains and ubiquitinates their client substrates through its U-box domain. This activity regulates diverse cellular processes including stress responses, apoptosis, and protein homeostasis. CHIP also modulates immune signaling and degradation of regulatory proteins, and its dysfunction is linked to diseases such as spinocerebellar ataxia and cancer.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Liu, Y., et al. (2023) Biomed Pharmacother 165: 115190 PMID 37506582

Ballinger, C.A., et al. (1999) Mol Cell Biol 19(6): 4535-4545 PMID 10330192

Connell, P., et al. (2001) Nat Cell Biol 3(1): 93-96 PMID 11146632

Alternate Names: STUB1; Antigen NY-CO-7; CLL-associated antigen KW-8; Carboxy terminus of Hsp70-interacting protein; STIP1 homology and U box-containing protein 1
Protein Sequence: MHHHHHHHHGSLEVLFQGPSMKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY