2 μg BpJOS Clippase run on 4-12% SDS-PAGE gel under reducing conditions, then visualized with Colloidal Coomassie Blue Stain.

BpJOS exhibits broad clippase activity toward diverse ubiquitin chain linkages. K6-, K11-, K29-, K33-, K48-, and K63-linked diubiquitin (Ub₂) and M1-linked tetraubiquitin (Ub₄) were incubated with BpJOS for 1, 10, and 30 min and analyzed by SDS–PAGE. BpJOS cleaved all tested Ub₂ linkages, producing monoubiquitin (Ub), while M1-linked Ub₄ was progressively converted to lower molecular weight ubiquitin species. Molecular weight markers (M) are indicated in kDa.

Active, Recombinant Burkholderia pyrrocinia BpJOS Clippase

DUBs

Product Code: TDE-142

Verified Applications: BpJOS Clippase is suitable for Ub-clipping workflows to generate diglycine (GG) remnants for ubiquitylation-site mapping, ubiquitome analysis, characterization of cellular ubiquitin conjugates, non-protein ubiquitination analysis, and NEDD8 clipping.

Activity: Verified by Polyubiquitin Chain Cleavage Assay.

Purity: 90 %

Concentration: 25 – 50 μM

For Research Use Only (RUO)

Quantity

Clear

Add to Quote

Need special pricing?

Academic Discount Bulk Request

Note: To maintain product quality, larger quantities may be packaged as multiple smaller aliquots. The 1 mg size is generally supplied in a single vial.

Predicted Molecular Weight: 28 kDa

Tag: N-Twin Strep-3C

Background and Additional Info

Background: Burkholderia pyrrocinia JOS (BpJOS) is a highly active ubiquitin C-terminal clippase (UCC) belonging to the bacterial Josephin family. Unlike conventional deubiquitylases that cleave after ubiquitin Gly76, BpJOS cleaves the peptide bond between Arg74 and Gly75, releasing C-terminally truncated ubiquitin while leaving a diglycine (GG) remnant attached to the modified substrate. BpJOS displays broad ubiquitin-linkage activity and has been shown to efficiently process cellular ubiquitin conjugates, enabling conversion of the ubiquitome into a GG-modified substrate population. This distinctive cleavage mechanism makes BpJOS a powerful reagent for mapping ubiquitin modification sites and studying ubiquitin conjugation independently of conventional deubiquitylation. BpJOS has also been demonstrated to process NEDD8 and has been applied to the detection and characterization of ubiquitylated non-protein substrates.

Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.

Storage and Stability: Frozen Dry Ice

Download the Datasheet

Protein Sequence: MWSHPQFEKGGGSGGGSGGSAWSHPQFEKSDLEVLFQGPMGHLKKIGGKPNGAASALGNSLKKALDTREPLSESNFLSGHVHPHDTPIHPGANGLFYHEIQRVDSGTCAVHAANAYSGSSQYNLHHFANAQSNMVGLDYNEAKGLILQDGNDPNFVKAVLNESKGAANTAHIAKSKTELADILDHVDRDIDRVMVGLAGPGESGHWVAFRKDGDKKWHKIDSYPRGIRASDPQPDQSPADFLRQRPGTESHYSIIYR