2 μg UBE2L3 run on 4-12% SDS-PAGE gel under reducing conditions

Active, Human, Recombinant UBE2L3

Enzyme

Product Code: TE2-010

Verified Applications: Recombinant Ubiquitin Conjugating Enzyme E2 L3 accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer directly to an E3 ligase of the RBR or HECT classes. Appropriate enzyme concentrations are specific to the application.

Activity: Verified in Ubiquitin Charging Assay.

Purity: 95%

Concentration: 50 μM

For Research Use Only (RUO)

Quantity

Clear

Add to Quote

Protein Name: UBE2L3

UniProt #: P68036

Predicted Molecular Weight: 18 kDa

Background and Additional Info

Background: Human UBE2L3 is a single-domain, 153 amino acid enzyme with the catalytic Cys86 embedded in the UBC fold. UBE2L3 only donates ubiquitin to ubiquitin E3 ligases of the RBR (e.g. Parkin, ARIH1/2, HOIP) or HECT ligases (e.g., HUWE1, E6AP). Its partnership with LUBAC licenses linear-Ub chain–driven NF-κB activation, whereas engagement by Parkin promotes mitochondrial quality control.

Formulation: 40 mM HEPES, 100 mM NaCl, 10% Glycerol, 1 mM EDTA, 1 mM TCEP, pH 7.6

Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.

Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).

Download the Datasheet

References: Wang, S., et al., (2012) Genes Immun 13:380-387. PMID 22476155

Lewis, M., et al., (2015) Am J Hum Genet 96:221-232. PMID 25640675

Horn-Ghetko, D., et al., (2021) Nature 590:671-676. PMID 33536622

Zeng, Y., et al., (2022) Front Mol Biosci 9:872130. PMID 35265070

Alternate Names: UbcH7, UBE2ALA

Protein Sequence: GPGSMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD