2 μg SMARCA4-BD run on 4-12% SDS-PAGE gel under reducing conditions, then visualized with Colloidal Coomassie Blue Stain.

Recombinant Human SMARCA4 Bromodomain

Accessory Proteins

Product Code: TAP-139

Verified Applications: Recombinant SMARCA4-BD has been functionally validated for use in in vitro biochemical binding assays, small-molecule inhibitor characterization, biophysical interaction studies (including SPR and ITC), structural biology, assay development, and targeted protein degradation research.

Activity: Verified in Ternary Complex Assay.

Purity: 95 %

Concentration: 50 μM

For Research Use Only (RUO)

Quantity

Clear

Add to Quote

Need special pricing?

Academic Discount Bulk Request

Note: To maintain product quality, larger quantities may be packaged as multiple smaller aliquots. The 1 mg size is generally supplied in a single vial.

Predicted Molecular Weight: 14 kDa

Tag: Untagged

Background and Additional Info

Background: SMARCA4 bromodomain (BRG1 BD) is a key acetyl-lysine recognition module within the catalytic ATPase subunit of the SWI/SNF (BAF) chromatin remodeling complex, where it contributes to ATP-dependent regulation of chromatin accessibility and transcription. By binding acetylated lysine residues on histone tails and other chromatin-associated proteins, the bromodomain helps recruit and position the remodeling complex at specific genomic loci to control gene expression. SMARCA4 bromodomain has emerged as an important target for epigenetic drug discovery, including the development of bromodomain inhibitors, molecular glues, and targeted protein degraders aimed at modulating SWI/SNF complex function in cancer and other diseases. Recombinant SMARCA4 bromodomain is supplied untagged and is well suited for biochemical and biophysical binding studies, inhibitor and degrader characterization, structural biology, and assay development.

Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.

Storage and Stability: Frozen Dry Ice

Download the Datasheet

Alternate Names: BAF190A, BRG1, SNF2B, SNF2L4

Protein Sequence: MAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD