Active, Recombinant Human FBXO3 / SKP1 Complex

E3 Ligases

Product Code: TE3-138
Verified Applications: Recombinant FBXO3 / SKP1 has been functionally validated for in vitro SCF E3 ubiquitin ligase reconstitution and ubiquitylation assays following assembly with CUL1-RBX1, supporting biochemical studies of FBXO3-dependent substrate ubiquitylation and inhibitor evaluation.
Activity: Verified in Ubiquitylation Assay.
Purity: 95 %
Concentration: 7.5 μM

For Research Use Only (RUO)

Add to Quote

Need special pricing?

Note: To maintain product quality, larger quantities may be packaged as multiple smaller aliquots. The 1 mg size is generally supplied in a single vial.

Predicted Molecular Weight: FBXO3: 51 kDa / SKP1: 19 kDa
Tag: FBXO3: N-6xHis / SKP1: Untagged

Background and Additional Info

Background: FBXO3 (F-box only protein 3) is the substrate recognition component of an SCF (SKP1–CUL1–F-box) E3 ubiquitin ligase complex that mediates selective ubiquitylation of target proteins involved in immune signaling, inflammation, and protein homeostasis. Through its conserved F-box domain, FBXO3 associates with SKP1 to form the core adaptor module required for assembly with CUL1-RBX1 and subsequent recruitment of ubiquitin-loaded E2 enzymes. FBXO3 has been implicated in the regulation of innate immune responses through the turnover of proteins that modulate inflammatory signaling pathways, making it an emerging target for therapeutic intervention in inflammatory and infectious diseases. This recombinant human FBXO3 / SKP1 complex provides a defined reagent for biochemical and biophysical studies of SCF complex assembly, substrate recognition, E3 ligase function, inhibitor discovery, and targeted protein degradation research.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Frozen Dry Ice
Protein Sequence: MHHHHHHGSMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEEEDEDDDS

MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK