Active, Recombinant Human FBXO42 / SKP1 Complex

E3 Ligases

Product Code: TE3-127
Verified Applications: The recombinant FBXO42 / SKP1 complex has been functionally validated for CUL1/RBX1-dependent in vitro ubiquitylation assays, where it supports reconstitution of active SCF E3 ligase complexes for studies of substrate ubiquitylation, E3 ligase mechanism, and targeted protein degradation workflows.
Activity: Verified in Ubiquitylation Assay with CUL1 / RBX1.
Purity: 85 %
Concentration: 25 μM

For Research Use Only (RUO)

Add to Quote

Need special pricing?

Note: To maintain product quality, larger quantities may be packaged as multiple smaller aliquots. The 1 mg size is generally supplied in a single vial.

Predicted Molecular Weight: FBXO42: 49 kDa / SKP1: 19 kDa
Tag: FBXO42: N-6xHis / SKP1: Untagged

Background and Additional Info

Background: F-box only protein 42 (FBXO42) is a substrate recognition component of the SKP1-CUL1-RBX1 (SCF) E3 ubiquitin ligase complex, where it recruits specific protein substrates for ubiquitylation and subsequent proteasomal degradation. Through its N-terminal F-box domain, FBXO42 binds SKP1 to assemble a functional SCF ligase, while its C-terminal substrate-binding region mediates selective target recognition. FBXO42 has been implicated in the regulation of cellular signaling, DNA damage responses, and protein quality control, although its substrate repertoire and biological functions continue to be actively investigated. Recombinant FBXO42 pre-complexed with SKP1 provides a stable, physiologically relevant substrate receptor complex for biochemical and structural studies of SCF ligase assembly, substrate recognition, inhibitor discovery, and targeted protein degradation (TPD) research.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Frozen Dry Ice
Alternate Names: FBX42, JFK, KIAA1332
Protein Sequence: MASIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGMHHHHHHGSEPHPVLEAEETRHNRSMSELPEEVLEYILSFLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHPACRVGQCVVVFSQAPS