2 μg Met1-linked Tetra-Ubiquitin run on 4-12% SDS-PAGE gel under reducing conditions, then visualized with Colloidal Coomassie Blue Stain.

Recombinant Human Met1-linked (Linear) Tetra-Ubiquitin

Polyubiquitin Chains

Product Code: TUB-045

Verified Applications: Ubiquitin chains exhibit diversity in length, linkage type, and associated cellular functions. M1-linked (Linear) Tetra-Ubiquitin serves as a valuable reagent in assays involving ubiquitin-binding proteins and as a substrate for ubiquitin-specific deubiquitylating enzymes (DUBs).

Activity: Polyubiquitin chains can serve as substrates in in vitro reactions with deubiquitylating enzymes (DUBs) that hydrolyze bonds between adjacent ubiquitin molecules. Furthermore, polyubiquitin chains can be utilized to explore the mechanisms of binding and recognition between these chains and other proteins with UIMs, UBAs, and/or other ubiquitin-binding motifs.

Purity: 95 %

Concentration: 29 μM

For Research Use Only (RUO)

Quantity

Clear

Add to Quote

Need special pricing?

Academic Discount Bulk Request

Note: To maintain product quality, larger quantities may be packaged as multiple smaller aliquots. The 1 mg size is generally supplied in a single vial.

UniProt #: Ub

Predicted Molecular Weight: 34 kDa

Tag: Untagged

Background and Additional Info

Background: Comprised of a linear ubiquitin tetramer in which four ubiquitin monomers are linked in a head-to-tail arrangement. Each linkage is formed between the C-terminal glycine (Gly76) of one ubiquitin and the N-terminal methionine (Met1) of the next, creating a continuous peptide chain. This M1-linked (linear) ubiquitin architecture mimics physiologically relevant polyubiquitin chains involved in signaling pathways such as NF-κB activation and immune regulation. The defined tetrameric structure provides a consistent and biologically relevant tool for studying ubiquitin-dependent processes, protein interactions, and enzymatic activities. It is particularly useful for biochemical assays, structural studies, and investigations into linear ubiquitylation mechanisms.

Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.

Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -20°C (stable for 24 months from date of receipt).

Download the Datasheet

Alternate Names: M1-Ub₄, Ub₄-M1

Protein Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG