2 μg JOSD1 run on 4-12% SDS-PAGE gel under reducing conditions, then visualized with Colloidal Coomassie Blue Stain.

Active, Recombinant Human JOSD1

DUBs

Product Code: TDE-068

Verified Applications: JOSD1 is commonly used in DUB enzymatic activity assays, ubiquitin linkage specificity studies (particularly K48-linked chains), proteasome function and protein stability assays, DUB inhibitor discovery and selectivity screening, cancer biology and drug resistance models, and activity-based probe labeling and target engagement studies.

Purity: 95 %

Concentration: 15-30 μM

For Research Use Only (RUO)

Quantity

Clear

Add to Quote

Need special pricing?

Academic Discount Bulk Request

Note: To maintain product quality, larger quantities may be packaged as multiple smaller aliquots. The 1 mg size is generally supplied in a single vial.

UniProt #: Q15040

Predicted Molecular Weight: 23 kDa

Tag: Untagged

Background and Additional Info

Background: Josephin domain-containing protein 1 (JOSD1) is a deubiquitylating enzyme (DUB) of the Josephin family of enzymes. JOSD1 has been reported to play roles in endocytosis and membrane biogenesis. While the majority of human DUB’s cleave “canonical” lysine-conjugated ubiquitin, recent reports demonstrate that JOSD1 prefers ubiquitin ester substrates, such as ubiquitylated serine and ubiquitylated threonine residues.

Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.

Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).

Download the Datasheet

References: De Cesare, V., et al. (2021) Proc Natl Acad Sci 118(4):e2006947118 PMID: 33479176

McClellan, A.J., et al. (2019) Open Biol 9(9): 190147 PMID: 31530095

Alternate Names: JSPH1, KIAA0063

Protein Sequence: GPSGMSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV