Active, Recombinant Human UCHL3

DUBs

Product Code: TDE-087
Verified Applications: Recombinant UCHL3 is a ubiquitin-specific hydrolase enzyme that has been verified to hydrolyze Ubiquitin-Rhodamine 110 substrate. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in Ubiquitin-Rhodamine Hydrolysis Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
Protein Name: UCHL3
UniProt #: P15374
Predicted Molecular Weight: 26 kDa
Tag: Untagged

Background and Additional Info

Background: Ubiquitin C-terminal hydrolase L3 (UCHL3) belongs to the UCH family of cysteine proteases and is widely expressed, with notable roles in the nervous system, germ cells, and various somatic tissues. UCHL3 has high affinity for ubiquitin and can process ubiquitin precursors and small ubiquitin adducts, helping maintain the free ubiquitin pool. Biologically, it influences DNA damage responses, cell cycle regulation, and apoptosis by modulating ubiquitylation of key regulatory proteins. UCHL3 also participates in spermatogenesis and neuronal function. Dysregulation or altered expression of UCHL3 has been implicated in cancer progression, neurodegenerative processes, and infertility, making it an important candidate for therapeutic targeting and biomarker development. Liu J., et al. (2025) Cancer Cell Int. 25: 276. PMID 40691601 Hafez N., et al. (2022) Eur J Med Chem. 227: 113970. PMID 34752952
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
Alternate Names: UCH-L3, Ubiquitin thioesterase L3
Protein Sequence: GPGSMEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA