Active, Recombinant Human UBE2H

E2 Conjugating Enzymes

Product Code: TE2-088
Verified Applications: Recombinant Ubiquitin Conjugating Enzyme E2 H accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer ubiquitin to a protein substrate in an E3 Ligase-catalyzed reaction. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in Ubiquitin Charging Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: P62256
Predicted Molecular Weight: 20 kDa
Tag: Untagged

Background and Additional Info

Background: UBE2H is a ubiquitin-conjugating enzyme (E2) that works with E3 ubiquitin ligases to catalyze the transfer of ubiquitin onto target proteins, directing them toward regulated turnover or functional modification. It participates in ubiquitin-dependent proteasomal degradation and has been implicated in pathways controlling protein homeostasis and cell fate decisions. UBE2H interacts with multiple RING-type E3 ligases and supports the formation of ubiquitin chains on selected substrates. Through these activities, it contributes to the regulation of cellular stress responses, apoptosis, and signaling networks. Dysregulation of UBE2H activity may disrupt normal ubiquitination dynamics, leading to altered protein stability and impaired cellular homeostasis.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Gronau T., et al. (2023) Molecular Cell 83:1–15. doi: 10.1016/j.molcel.2023.11.027

David Y., et al. (2010) Journal of Biological Chemistry 285(12):8595–8604. doi: 10.1074/jbc.M109.089003 PMID 20061386

Kaiser P., et al. (1995) FEBS Letters 377(2):193–196. doi: 10.1016/0014-5793(95)01323-7 PMID 8543049

Alternate Names: UBC8, UBCH, UBCH2, E2-20K
Protein Sequence: GPMSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL