Recombinant Human Ubiquitin, His-tag

Ub/Ubl's

Product Code: TUB-040
Verified Applications: Recombinant His-tagged ubiquitin is activated for use in vitro by Recombinant Ubiquitin Activating Enzyme 1 (UBA1). This initial event in the ubiquitin-proteasome cascade requires Mg-ATP and ubiquitin. Appropriate protein concentrations are specific to the application.
Activity: Verified in Ubiquitin Charging Assay. Verified to bind to IMAC resin.
Purity: 95 %
Concentration: 400 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: Ub
Predicted Molecular Weight: 9.7 kDa
Tag: N-6xHis

Background and Additional Info

Background: Ubiquitin is a small regulatory protein that plays critical roles in various cellular processes in eukaryotic organisms. Its primary function is to tag proteins for degradation. This process, known as ubiquitylation, involves the attachment of ubiquitin molecules to substrate proteins, signaling them for destruction by the proteasome. Additionally, ubiquitylation also regulates many other cellular functions, including DNA repair, cell cycle regulation, and response to stress.
Shipping: The product is shipped with cold packs or dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -20°C (stable for 48 months from date of receipt).
Protein Sequence: MHHHHHHGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG