Active, Recombinant Human BRD4 Bromodomain 1 (49-170)

Accessory Proteins

Product Code: TAP-077
Verified Applications: BRD4 (49-170), AVI-tag is active in ternary complex formation assays using recombinant CRBN/DDB1 and the degrader molecule dBET-1.
Activity: Verified in Ternary Complex Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: O60885
Predicted Molecular Weight: 21 kDa
Tag: N-AVI (Biotinylated)

Background and Additional Info

Background: BRD4 (Bromodomain-containing protein 4) is a member of the BET (bromodomain and extra-terminal) family of proteins. BRD4 contains two bromodomains that recognize acetylated lysine residues on histone tails, enabling it to bind to chromatin and influence transcription. BRD4 plays a crucial role in mediating the transcriptional regulation of genes involved in cell cycle progression, proliferation, and differentiation. Targeting BRD4 with small molecule inhibitors, such as BET inhibitors, is a therapeutic strategy for various cancers, as these inhibitors can disrupt the pro-tumorigenic functions of BRD4, leading to decreased tumor growth and survival. BRD4 and other bromodomain proteins are frequent targets in the development of PROTACs (Proteolysis Targeting Chimeras). Small molecules such as dBET-1 recruit E3 ubiquitin ligases to BRD4, leading to its ubiquitylation and subsequent proteasomal degradation.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Filippakopoulos P., et al. (2010) Nature 468(7327): 1067-73 PMID: 20871596

Jang M.K., et al. (2005) Mol Cell . 19(4): 523-34 PMID: 16109376

Zeng L., et al. (2002) FEBS Letters 513 (1): 124–8 PMID: 11911891

Alternate Names: HUNK1
Protein Sequence: SFGLNDIFEAQKIEWHETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETE