Active, Recombinant Human FKBP12

Accessory Proteins

Product Code: TAP-072
Verified Applications: FKBP12, AVI-tag, is active in ternary complex formation assays using recombinant FBXO22/SKP1 and the degrader molecule SP3CHO.
Activity: Verified in Ternary Complex Assay.
Purity: 95 %
Concentration: 40-50 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: P62942
Predicted Molecular Weight: 14 kDa
Tag: N-AVI (Biotinylated)

Background and Additional Info

Background: FKBP12 (FK506-binding protein 12) is a small, cytoplasmic immunophilin that functions as a peptidyl-prolyl isomerase, assisting in protein folding by catalyzing the cis-trans isomerization of proline residues. It plays a critical role in regulating cellular processes such as calcium signaling, immune response, and cell growth. FKBP12 is well known for its ability to bind immunosuppressive drugs like FK506 (tacrolimus) and rapamycin, forming complexes that inhibit key signaling pathways. One of its primary biological roles involves regulating the ryanodine receptor (RyR) calcium channels in the endoplasmic reticulum, impacting calcium release and muscle contraction. FKBP12 is also involved in modulating mTOR signaling through its interaction with rapamycin-bound complexes. Dysregulation or mutations of FKBP12 can be linked to various diseases, including autoimmune disorders, cardiac hypertrophy, and certain cancers, highlighting its importance in cellular regulation and potential as a therapeutic target.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Kagiou C., et al. (2024) Nat Commun. 15: 5409 PMID: 38926334

Chen S.R., et al. (1994) Proc Natl Acad Sci 91(25): 11953-11957 PMID: 7527548

Lanner J.T., et al. (2010) Cold Spring Harb Perspect Biol. 2(11): a003996 PMID: 20961976

Ge P., et al. (2025) Phytomedicine 142:156771 PMID: 40279970

Yang H., et al. (2013) Nature 497: 217-223 PMID 23636326

Alternate Names: 12 kDa FK506-binding protein; 12kDA FKBP; FKBP-12; Calstabin-1 FK506-binding protein 1A (FKBP-1A); Immunophilin FKBP12; Rotamase
Protein Sequence: SFGLNDIFEAQKIEWHEGSMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEGSGC