Active, Recombinant Legionella pneumophila LotA-N

DUBs

Product Code: TDE-064
Verified Applications: Recombinant L. pneumophila LotA-N is a ubiquitin-specific deconjugating enzyme that is highly specific for K6-linked polyubiquitin. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in K6-linked Di-Ubiquitin Hydrolysis Assay.
Purity: 95 %
Concentration: 50 – 60 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: Q5ZTB4
Predicted Molecular Weight: 34 kDa
Tag: N-6xHis-3C

Background and Additional Info

Background: LotA-N is a 28 kDa OTU fold class deubiquitylase (DUB) derived from the Legionella pneumophila effector protein LotA. In addition to the OTU fold, LotA-N has an extended β-hairpin and helical insert that create a deep S1′ cradle for the proximal ubiquitin. A high-resolution structure (PDB: 7W54) revealed that the enzyme utilizes a mechanism for K6 recognition that is uncommon to OTU DUBs. During infection, LotA is translocated into the Legionella-containing vacuole, where it strips K6 chains that would otherwise recruit the p97/VCP segregase and promote lysosomal clearance of the vacuole.
Formulation: 40 mM HEPES, 100 mM NaCl, 10% Glycerol, 1 mM EDTA, 1 mM TCEP, pH 7.6.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Shin, D., et al., (2020) eLife 9:e58277. PMID 33185526

Luo, J., et al., (2022) J Biol Chem 298:102414. PMID 36007613

Takekawa, N., et al., (2022) J Bacteriol 204:e00376-21. PMID 34633867

Warren, G. D., et al., (2023) Mol Cell 83:105-120.e5. PMID 36538933

Zhang, Z., and C. Das. (2023) Trends Microbiol 31:423-425. PMID 36890008

Alternate Names: None
Protein Sequence: MHHHHHHGSLEVLFQGPGSMAKTIKATGDGACLFNAVSIGLSVEILSGRLDSQLDTPGYQALLDEFAKHHPQFNPKSWKTLKEWLAYYNDTRDIELILAPVLFNLNQKYQDHLDEEILNELTNLVWKNKANIENGQAWFQLQNTGDLGEALFPKLENLDLKKDRAPLLDKLREILKDYKLELTRENVKQFLTEKAKELLSALKKKISSDPHAFQRGYSCDELKGMTDALAISLVENREEDITDNRIKIRLENQEEHWNVLCNEEDSERFLDSTPSRLKMTSLEAYRGDKQVSAPT