Active, Recombinant Human VHL / ELOB / ELOC Complex

E3 ligases

Product Code: TE3-019
Verified Applications: VHL / ELOB / ELOC is active in ternary complex formation assays using recombinant BRD4 and the degrader molecule MZ1.
Activity: Verified in Ternary Complex Assay.
Purity: 95 %
Concentration: 10-30 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: P40337 ; Q15369 ; Q15370
Predicted Molecular Weight: VHL: 27 kDa / ELOB: 13 kDa / ELOC: 12 kDa
Tag: VHL: N-8xHis-3C / ELOB: Untagged / ELOC: Untagged

Background and Additional Info

Background: von Hippel-Lindau tumor suppressor (VHL) is a crucial gene involved in regulating cell growth and stability. It encodes the substrate recognition subunit of the cullin E3 ligase CRL-VHL. Under normal oxygen conditions, the VHL protein helps degrade hypoxia-inducible factors (HIFs), which are transcription factors that activate genes involved in angiogenesis, metabolism, and cell survival. When oxygen levels are sufficient, VHL binds to HIFs and tags them for destruction via the ubiquitin-proteasome pathway. VHL is widely used in targeted protein degradation strategies, particularly in the development of PROTACs™ (Proteolysis Targeting Chimeras). PROTACs™ are bifunctional molecules that simultaneously bind to a target protein and an E3 ubiquitin ligase, like VHL. When a PROTAC™, such as MZ1, recruits VHL to a specific target protein, VHL facilitates the ubiquitylation of that protein, marking it for destruction by the proteasome.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Zengerle M., et al. (2015) ACS Chem. Biol 10(8): 1770-1777. PMID: 26035625

Zhang J., Zhang Q. (2018) Biomedicines 6(1): 35. PMID: PMC5874692

Tanimoto K., et al. (2000) EMBO J. 19: 4298-4309. PMID: 10944113

Alternate Names: von Hippel-Lindau
Protein Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
MGHHHHHHHHGSGSLEVLFQGPGSMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD