Active, Recombinant Human UBE2S-UBD

Accessory Proteins

Product Code: TAP-067
Verified Applications: Recombinant Ubiquitin Conjugating Enzyme UBE2S-UBD accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 fusion protein subsequently generates unanchored polyubiquitin chains. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in Polyubiquitin Chain Synthesis Assay.
Purity: 95 %
Concentration: 40-50 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: P45974 ; Q16763
Predicted Molecular Weight: 36 kDa
Tag: N-8xHis

Background and Additional Info

Background: The construct joins UBE2S’s UBC core (aa 1-156) to IsoT’s ZnF-UBP (aa 171-250) via a flexible Gly-Ser linker. Crystal and NMR work on the parental domains reveal an open E2 active site aligned coaxially with the ZnF pocket that grips ubiquitin’s Gly-Gly tail, pre-orienting Lys11 for attack. Wild-type UBE2S extends Lys11 chains on APC/C-primed substrates to drive mitotic exit. The fusion mimics this activity without an initiator E2, efficiently decorating Ub-loaded substrates or free ubiquitin to create long Lys11 polymers; in cellular reconstitution, it restores APC/C activity and stimulates substrate priming in trans.
Shipping: The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Reyes-Turcu, F. E., et al., (2006) Cell 124:1197-1208. PMID 16564012

Bremm, A., et al., (2010) Nat. Struct. Mol. Biol. 17:939-947 PMID 20622874

Lorenz, S., et al., (2016) PLoS One 11:e0147550. PMID 26828794

Paul, A., and B. Wang. (2017) Mol Cell 66:458-472. PMID 28525740

Martinez-Chacin, R. C., et al., (2020) Nat. Struct. Mol. Biol. 27:550-560. PMID 32393902

Alternate Names: Synthetic chimera often abbreviated UBE2S-IsoT or UBE2S-UPS5
Protein Sequence: MGSHHHHHHHHEGSGSMNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKT