Active, Recombinant Human UBE2M

E2 Conjugating Enzymes

Product Code: TE2-011
Verified Applications: Recombinant NEDD8 Conjugating Enzyme E2 M accepts activated NEDD8 from NEDD8 Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer NEDD8 to a protein substrate in an E3 Ligase-catalyzed reaction. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in NEDD8 Charging Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: P61081
Predicted Molecular Weight: 21 kDa
Tag: Untagged

Background and Additional Info

Background: UBE2M (also called UBC12) is a human E2 ubiquitin-conjugating enzyme specialized for the NEDD8 pathway. It catalyzes transfer of NEDD8, a ubiquitin-like modifier, from the E1 NEDD8-activating enzyme to substrate proteins, primarily cullin family scaffold proteins in Cullin-RING E3 ligases (CRLs). NEDD8 conjugation (neddylation) activates CRLs, promoting ubiquitin-dependent proteasomal degradation of many regulatory proteins involved in cell cycle, DNA repair, and signal transduction pathways. UBE2M works with E3 NEDD8 ligases (e.g., RBX1) and is regulated by expression levels, post-translational modifications, and interactions with deneddylases (e.g., CSN). Dysregulation of UBE2M/neddylation is implicated in cancer and other diseases.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Gong L., & Yeh, E.T. (1999) J Biol Chem 274(17):12036-12042. PMID 10207026

Huang D.T., et al., (2004) 11(10):927-935. PMID 15361859

Alternate Names: Ubc12
Protein Sequence: GPGSMIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK