2 μg UBE2D3 run on 4-12% SDS-PAGE gel under reducing conditions
Active, Human, Recombinant UBE2D3
Enzyme
Product Code: TE2-004
Activity: Verified in Ubiquitin Charging Assay.
Purity: 95%
Concentration: 50 μM
For Research Use Only (RUO)
Protein Name: UBE2D3
UniProt #: P61077
Predicted Molecular Weight: 17 kDa
Background and Additional Info
Background: Ubiquitin-Conjugating Enzyme E2 D3 (UBE2D3) is an E2 ubiquitin-conjugating enzyme that facilitates the transfer of ubiquitin from E1 activating enzymes to substrate proteins. This 147 amino acid protein is almost entirely UBC domain: an N-terminal α-helix for E3 docking, a four-stranded β-sheet, three α-helices and flexible catalytic loops. UBE2D3 forms thioester-linked UBE2D3-ubiquitin conjugates that cooperate with myriad E3s, including BRCA1/BARD1 in DNA repair, CHIP in chaperone quality control and MDM2 or PIRH2 in p53 turnover.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
Yang, J., et al., (2021) Cancer Res. 81:898-909 PMID 33277368
Alternate Names: UbcH5c
Protein Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM