Active, Human, Recombinant UBE2D3

Enzyme

Product Code: TE2-004
Activity: Verified in Ubiquitin Charging Assay.
Purity: 95%
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
Protein Name: UBE2D3
UniProt #: P61077
Predicted Molecular Weight: 17 kDa

Background and Additional Info

Background: Ubiquitin-Conjugating Enzyme E2 D3 (UBE2D3) is an E2 ubiquitin-conjugating enzyme that facilitates the transfer of ubiquitin from E1 activating enzymes to substrate proteins. This 147 amino acid protein is almost entirely UBC domain: an N-terminal α-helix for E3 docking, a four-stranded β-sheet, three α-helices and flexible catalytic loops. UBE2D3 forms thioester-linked UBE2D3-ubiquitin conjugates that cooperate with myriad E3s, including BRCA1/BARD1 in DNA repair, CHIP in chaperone quality control and MDM2 or PIRH2 in p53 turnover.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).

Download the Datasheet

References: Geisler S, et al., (2014) J Cell Sci 127:3280–3293. PMID 24906799

Witus, S., et al., (2021) Nat Struct Mol Biol 28:268-277. PMID 33589814

Yang, J., et al., (2021) Cancer Res. 81:898-909 PMID 33277368

Alternate Names: UbcH5c
Protein Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM