Verified Applications: Recombinant Ubiquitin Conjugating Enzyme E2 D2 accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer ubiquitin to a protein substrate in an E3 Ligase-catalyzed reaction. Appropriate enzyme concentrations are specific to the application.
2 μg UBE2D2 run on 4-12% SDS-PAGE gel under reducing conditions, then visualized with Colloidal Coomassie Blue Stain.
Formulation: 40 mM HEPES, 100 mM NaCl, 10% Glycerol, 1 mM EDTA, 1 mM TCEP, pH 7.6
Shipping: The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
Protein Sequence: GPGSMALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
Background Information and Alternate Names
Species & domain architecture
The 152-aa protein is almost entirely UBC domain: an N-terminal α-helix for E3 docking, a four-stranded β-sheet, three α-helices and flexible catalytic loops. The NMR solution structure plus multiple RING-bound crystal complexes define an open ↔ closed continuum that underlies its linkage breadth.
UPS pathway role
UBE2D2 forms thioester-linked UBE2D2~Ub intermediates that cooperate with myriad E3s, including TRAF6 in innate-immune signaling, CHIP in chaperone quality control and MDM2 or PIRH2 in p53 turnover. Its ability to seed or elongate Lys11/48/63 chains lets RING ligases toggle signals between proteasomal degradation, signaling scaffolds and cell-cycle checkpoints.
Relevance to TPD & disease biology
UBE2D2 is frequently up-regulated in breast and other solid tumors; circular RNA circ-UBE2D2 enhances migration, invasion and poor prognosis by sponging miR-1236/1287. Targeting the UBE2D2–RING interface or biasing it toward a single linkage offers routes to dampen oncogenic NF-κB or Wnt outputs while preserving essential housekeeping ubiquitylation.
References
Houben, K., et al., (2004) J Mol Biol 344:513-526. PMID 15522302
Markson, G., et al., (2009) Genome Res 19:1905-1911. PMID 19549727
Bosanac, I., et al., (2011) J Mol Biol 408:420-431. PMID 21396940
Plechanovova, A., et al., (2012) Nature 489:115-120. PMID 22842904
Wang, Y., et al., (2019) Transl Oncol 12:1305-1313. PMID 31336316
