Active, Recombinant Human UBE2D1

E2 Conjugating Enzymes

Product Code: TE2-002
Verified Applications: Recombinant Ubiquitin Conjugating Enzyme E2 D1 accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer ubiquitin to a protein substrate in an E3 Ligase-catalyzed reaction. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in Ubiquitin Charging Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
Protein Name: UBE2D1
UniProt #: P51668
Predicted Molecular Weight: 17 kDa
Tag: Untagged

Background and Additional Info

Background: Ubiquitin-Conjugating Enzyme E2 D1 (UBE2D1) is an E2 ubiquitin-conjugating enzyme that facilitates the transfer of ubiquitin from E1 activating enzymes to substrate proteins. This 147 amino acid protein is almost entirely UBC domain: an N-terminal α-helix for E3 docking, a four-stranded β-sheet, three α-helices and flexible catalytic loops. UBE2D1 is widely expressed in tissues, indicating its importance in multiple physiological processes. Its expression levels can be influenced by different stimuli, such as stress or hormonal changes. UBE2D1 interacts with various ubiquitin E3 ligases such as CHIP, MDM2, RNF4, SMURF2 and Parkin.
Formulation: 40 mM HEPES, 100 mM NaCl, 10% Glycerol, 1 mM EDTA, 1 mM TCEP, pH 7.6
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Xu, Z., et al., (2008) BMC Struct Biol 8:26. PMID 18485199

Bosanac, I., et al., (2011) J Mol Biol 408:420-431. PMID 21396940

Plechanovova, A., et al., (2012) Nature 489:115-120. PMID 22842904

Shukla, S., et al., (2014) Neoplasia 16:115-128. PMID 24709419

Alternate Names: UbcH5a, UBCH5A
Protein Sequence: GPGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM