Active, Recombinant Human SENP1 (411-644)

DUBs

Product Code: TDE-069
Verified Applications: Recombinant human Sentrin-specific protease 1 removes SUMO modifications from proteins in in vitro reactions. This is particularly useful in cleaving SUMO tags from recombinant proteins. Appropriate enzyme concentrations are specific to the application.
Activity: 100 nM SENP1 will cleave 50 μg SUMOylated test protein in 2 hours at 4°C.
Purity: 95 %
Concentration: 50-60 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: Q9P0U3
Predicted Molecular Weight: 28 kDa
Tag: Untagged

Background and Additional Info

Background: SENP1 (sentrin/SUMO-specific protease 1) is a cysteine protease that reverses SUMOylation by processing SUMO precursors and deconjugating SUMO from target proteins. Structurally, it has an N-terminal regulatory region and a conserved C-terminal catalytic domain. By removing SUMO modifications, SENP1 modulates the activity, stability, and localization of transcription factors, signaling proteins, and DNA-repair factors, thereby influencing cell-cycle progression, apoptosis, and stress responses. SENP1 is upregulated by hypoxia and can enhance hypoxic signaling (for example, via HIF‑1α), and its dysregulation is linked to tumorigenesis and metastasis. In vitro, SENP1 is useful in removing SUMO fusion tags from recombinant proteins, or for de-SUMOylating proteins in lysates.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Gong, L., et al. (2000) J Biol Chem 275(5):3355-9225. PMID 10652325

Xu, Z. & Au, S.W.N. (2005) Biochem J 386(Pt 2):325-330. PMID 15487983

Kim, Y.H., et al. (2005) FEBS Lett 579(27):6272-8627. PMID 16253240

Protein Sequence: GPGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL