Active, Recombinant Human JOSD1

DUBs

Product Code: TDE-068
Verified Applications: JOSD1 is commonly used in DUB enzymatic activity assays, ubiquitin linkage specificity studies (particularly K48-linked chains), proteasome function and protein stability assays, DUB inhibitor discovery and selectivity screening, cancer biology and drug resistance models, and activity-based probe labeling and target engagement studies.
Purity: 95 %
Concentration: 15-30 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: Q15040
Predicted Molecular Weight: 23 kDa
Tag: Untagged

Background and Additional Info

Background: Josephin domain-containing protein 1 (JOSD1) is a deubiquitylating enzyme (DUB) of the Josephin family of enzymes. JOSD1 has been reported to play roles in endocytosis and membrane biogenesis. While the majority of human DUB’s cleave “canonical” lysine-conjugated ubiquitin, recent reports demonstrate that JOSD1 prefers ubiquitin ester substrates, such as ubiquitylated serine and ubiquitylated threonine residues.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: De Cesare, V., et al. (2021) Proc Natl Acad Sci 118(4):e2006947118 PMID: 33479176

McClellan, A.J., et al. (2019) Open Biol 9(9): 190147 PMID: 31530095

Alternate Names: JSPH1, KIAA0063
Protein Sequence: GPSGMSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV