2 μg JOSD1 run on 4-12% SDS-PAGE gel under reducing conditions
Active, Human, Recombinant JOSD1
Enzyme
Product Code: TDE-068
Purity: 95%
Concentration: 15-30 μM
For Research Use Only (RUO)
Protein Name: JOSD1
UniProt #: Q15040
Predicted Molecular Weight: 23 kDa
Background and Additional Info
Background: Josephin domain-containing protein 1 (JOSD1) is a deubiquitylating enzyme (DUB) of the Josephin family of enzymes. JOSD1 has been reported to play roles in endocytosis and membrane biogenesis. While the majority of human DUB’s cleave “canonical” lysine-conjugated ubiquitin, recent reports demonstrate that JOSD1’s markedly prefers ubiquitin ester substrates, such as ubiquitylated serine and ubiquitylated threonine residues.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
Download the Datasheet
References: De Cesare, V., et al. (2021) Proc Natl Acad Sci 118(4):e2006947118 PMID: 33479176
McClellan, A.J., et al. (2019) Open Biol 9(9): 190147 PMID: 31530095
Protein Sequence: GPSGMSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV
2 μg JOSD1 run on 4-12% SDS-PAGE gel under reducing conditions