Active, Human, Recombinant FBXO22/SKP1, tagged

Enzyme

Product Code: TE3-028
Verified Applications: FBXO22/SKP1 is active in ternary complex formation assays using recombinant FKBP12 and the degrader molecule SP3CHO.
Activity: Ternary Complex Assay
Purity: 95%
Concentration: 15-30 μM

For Research Use Only (RUO)

Add to Quote
Protein Name: FBXO22/SKP1
UniProt #: P63208;Q8NEZ5
Predicted Molecular Weight: 47 kDa (FBXO22) / 23 kDa (SKP1)

Background and Additional Info

Background: FBXO22 is a member of the F-box protein family and is the substrate recognition subunit of an SCF (Skp1-Cullin-F-box) E3 ubiquitin ligase complex. This complex plays a crucial role in targeting specific proteins for ubiquitylation and subsequent degradation by the proteasome, thereby regulating various cellular processes. FBXO22 is involved in controlling cell cycle progression, signal transduction, and immune responses by targeting substrates such as p53, and mTOR. FBXO22-based degradation tools are still in early stages of development compared to more established ligases like VHL or CRBN, but they hold promise for expanding the toolkit of targeted protein degradation for therapeutic applications.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).

Download the Datasheet

References: Kagiou C., et al. (2024) Nat Commun. 15: 5409 PMID: 38926334

Ge M-K., et al. (2023) Cell Metab. 35: 2216-2230 PMID: 37979583

Johmura Y, et al. (2016) Nat Commun. 7: 10574 PMID: 26868148

Alternate Names: SKP1 (S-phase kinase–associated protein 1; FBXO22 (F-box only protein 22;
Protein Sequence: MGHHHHHHHHGSENLYFQSGMEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVLRTHRSVTWISAGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK