Active, Recombinant Escherichia coli O157:H7 NleL

E3 ligases

Product Code: TE3-020
Verified Applications: In vitro, recombinant NleL accepts activated ubiquitin from E2 conjugating enzyme UBE2L3 in a reaction that also requires Ubiquitin Activating Enzyme 1 (an E1). The charged E3 demonstrates strong autoubiquitylation and generation of unanchored polyubiquitin in the absence of added substrates. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in Polyubiquitin Chain Synthesis Assay.
Purity: 95 %
Concentration: 15-20 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: A0A0H3JDV8
Predicted Molecular Weight: 70 kDa
Tag: Untagged

Background and Additional Info

Background: NleL is a type III secretion system effector protein produced by pathogenic Escherichia coli strains. It functions as an E3 ubiquitin ligase, modulating host cell signaling pathways by ubiquitylating host proteins, thereby promoting infection. NleL comprises an N-terminal β-helix formed by pentapeptide repeats (residues 1–250) and a C-terminal bi-lobed bacterial HECT (bHECT) catalytic domain. Key motifs include the catalytic Cys387 and an E2-binding patch. NleL positions itself downstream of host E2 enzymes, directly catalyzing ubiquitin transfer to host substrates or building unanchored K6- and K48-linked polyubiquitin chains.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Franklin, T.G., et al. (2023) Mol Cell 83:4538–4554. PMID 38091999

Piscatelli, H., et al., (2011) PLoS ONE 6:e19331. PMID 21541301

Lin, D. Y-W., et al., (2012) PNAS 109:1925-1930. PMID 22308380

Hospenthal, M. K., et al., (2013) Nat. Struct. Mol. Biol. 20:555-565. PMID 23563141

Sheng, X., et al., (2017) PLoS Pathog 13:e1006534. PMID 28753655

Alternate Names: NleL (Non-LEE encoded effector L), espX7, SopA
Protein Sequence: GPLGSQGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR