Active, Recombinant Human UBE2V1 / UBE2N Complex

E2 Conjugating Enzymes

Product Code: TE2-013
Verified Applications: Recombinant Ubiquitin Conjugating Enzyme E2 2V1/2N accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer ubiquitin to a protein substrate in an E3 Ligase-catalyzed reaction. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in Ubiquitin Charging Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: P61088 ; Q13404
Predicted Molecular Weight: UBE2V1: 17 kDa / UBE2N: 17 kDa
Tag: UBE2V1: Untagged / UBE2N: Untagged

Background and Additional Info

Background: UBE2N is a 152 amino acid UBC fold with catalytic residue Cys87; UBE2V1 is 154 amino acids, conserving the β-sheet/α-helical scaffold but replacing the active cysteine with Ser32. Crystal and NMR structures of UBE2N-ubiquitin bound to UBE2V1 (and yeast Mms2) reveal how UBE2V1 positions an acceptor ubiquitin so that its Lys63 lines up with UBE2N’s thioesterified ubiquitin. This E2 heterodimer works with diverse RING E3 enzymes. In innate immunity, UBE2V1 / UBE2N partners with TRAF6 to assemble K63 chains that recruit TAB2 / TAK1 and activate NF-κB signaling. In genome maintenance, it collaborates with RAD5-like E3s to polyubiquitylate PCNA, licensing error-free template switching and fork reversal after DNA damage.
Formulation: 40 mM HEPES, 100 mM NaCl, 10% Glycerol, 1 mM EDTA, 1 mM TCEP, pH 7.6
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Deng, L., et al., (2000) Cell 103:351-361. PMID 11057907

McKenna, S., et al., (2003) J Biol Chem 278:13151-13158. PMID 12569095

Eddins, M. J., et al., (2006) Nat. Struct. Mol. Biol. 13:915-920. PMID 16980971

Hodge, C.D., et al., (2016) Oncotarget 7:64471-64504. PMID 27486774

Vujanovic, M., et al., (2017) Mol Cell 67:882-890. PMID 28886337

Alternate Names: Uev1a/Ubc13, Uev1a/UbcH13
Protein Sequence: GPGSMAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
GPGSMAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI