2 μg UBE2L3 run on 4-12% SDS-PAGE gel under reducing conditions, then visualized with Colloidal Coomassie Blue Stain.

Active, Human, Recombinant UBE2L3

E2 conjugating enzymes

Product Code: TE2-010

Verified Applications: Recombinant Ubiquitin Conjugating Enzyme E2 L3 accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer directly to an E3 ligase of the RBR or HECT classes. Appropriate enzyme concentrations are specific to the application.

Activity: Verified in Ubiquitin Charging Assay.

Purity: 95%

Concentration: 50 μM

For Research Use Only (RUO)

Protein Name: UBE2L3

UniProt #: P68036

Predicted Molecular Weight: 18.2

Background and Additional Info

Background: Human UBE2L3 is a single-domain, 153 amino acid enzyme with the catalytic Cys86 embedded in the UBC fold. Crystal structures such as UBE2L3 bound to the HOIP RING1 domain (PDB 7V8F) reveal the extended “acidic loop” that positions ubiquitin for transfer to E3 active sites. UBE2L3 only donates ubiquitin to ubiquitin E3 ligases of the RBR (e.g. Parkin, ARIH1/2, HOIP) or HECT ligases (e.g., HUWE1, E6AP). Its partnership with LUBAC licenses linear-Ub chain–driven NF-κB activation, whereas engagement by Parkin promotes mitochondrial quality control.

Formulation: 40 mM HEPES, 100 mM NaCl, 10% Glycerol, 1 mM EDTA, 1 mM TCEP, pH 7.6

Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.

Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).

Download the Datasheet

Additional Product Information

References:

Wang, S., et al., (2012) Genes Immun 13:380-387. PMID 22476155

Lewis, M., et al., (2015) Am J Hum Genet 96:221-232. PMID 25640675

Horn-Ghetko, D., et al., (2021) Nature 590:671-676. PMID 33536622

Zeng, Y., et al., (2022) Front Mol Biosci 9:872130. PMID 35265070

Alternate Names: UbcH7, UBE2ALA

Protein Sequence: GPGSMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD