Active, Recombinant Human UBE2D2

E2 Conjugating Enzymes

Product Code: TE2-003
Verified Applications: Recombinant Ubiquitin Conjugating Enzyme E2 D2 accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer ubiquitin to a protein substrate in an E3 Ligase-catalyzed reaction. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in Ubiquitin Charging Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: P62837
Predicted Molecular Weight: 17 kDa
Tag: Untagged

Background and Additional Info

Background: Ubiquitin-Conjugating Enzyme E2 D2 (UBE2D2) is an E2 ubiquitin-conjugating enzyme that facilitates the transfer of ubiquitin from E1 activating enzymes to substrate proteins. This 152 amino acid protein is almost entirely UBC domain: an N-terminal α-helix for E3 docking, a four-stranded β-sheet, three α-helices and flexible catalytic loops. The NMR solution structure plus multiple RING-bound crystal complexes define an open ↔ closed continuum. UBE2D2 forms thioester-linked UBE2D2-ubiquitin conjugates that cooperate with myriad E3s, including TRAF6 in innate-immune signaling, CHIP in chaperone quality control and MDM2 or PIRH2 in p53 turnover.
Formulation: 40 mM HEPES, 100 mM NaCl, 10% Glycerol, 1 mM EDTA, 1 mM TCEP, pH 7.6
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Houben, K., et al., (2004) J Mol Biol 344:513-526. PMID 15522302

Markson, G., et al., (2009) Genome Res 19:1905-1911. PMID 19549727

Wang, Y., et al., (2019) Transl Oncol 12:1305-1313. PMID 31336316

Alternate Names: UbcH5b, E2D2
Protein Sequence: GPGSMALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM