Active, Recombinant Human FBXO31 / SKP1 Complex

E3 Ligases

Product Code: TE3-091
Verified Applications: FBXO31 supports substrate-dependent ubiquitylation in reconstituted SCF complex assays and is used to validate substrate targeting in biochemical assays. It is also applied in targeted protein degradation studies and in investigating cell cycle regulation and oxidative stress–induced protein turnover.
Activity: Verified in Binary Complex Assay.
Purity: 90 %
Concentration: 15-30 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: P63208 ; Q5XUX0
Predicted Molecular Weight: FBXO31: 55 kDa / SKP1: 18 kDa
Tag: FBXO31: N-6xHis / SKP1: Untagged

Background and Additional Info

Background: FBXO31 (F-box only protein 31) is an F-box protein that functions as a substrate-recognition subunit of the SCF (SKP1–CUL1–F-box) E3 ubiquitin ligase complex. It contains an F-box domain that binds SKP1 and multiple substrate-interacting motifs, allowing it to target specific proteins for ubiquitylation and proteasomal degradation. Biologically, FBXO31 has been implicated in cell-cycle regulation, particularly the G1/S and G2/M transitions, through degradation of key regulators such as cyclin D1. In response to oxidative stress, FBXO31 selectively tags proteins with C‑terminal amidation for ubiquitylation, thereby targeting them for proteasomal degradation. Targeted Protein Degradation (TPD) approaches have recently attempted to mimic the C-terminal amide degron as a means of developing bivalent degraders.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Muhar, M.F., et al. (2025) Nature 638(8050):519-527 PMID: 39880951

Li, Y., et al. (2018) Proc Natl Acad Sci 115(2):319-324 PMID: 29279382

Dutta, P. et al. (2019) J Biol Chem 294(41):14879-14895 PMID: 31413110

Alternate Names: FBX14; FBX31
Protein Sequence: MASIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
MHHHHHHGSLLELPPELLVEIFASLPGTDLPSLAQVCTKFRRILHTDTIWRRRCREEYGVCENLRKLEITGVSCRDVYAKLLHRYRHILGLWQPDIGPYGGLLNVVVDGLFIIGWMYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS