CUL1 / RBX1, Neddylated

E3 Ligases

Product Code: TE3-029
Verified Applications: Neddylated CUL1 / RBX1 combined with SKP1 / FBXO22 will ubiquitylate FKBP12 in an SP3CHO-dependent manner using suitable conditions.
Activity: Active in Ubiquitylation Assay.
Purity: 85 %
Concentration: 5-10 μM

For Research Use Only (RUO)

Add to Quote
Predicted Molecular Weight: CUL1: 90 kDa / RBX1: 12 kDa / NEDD8: 8.6 kDa
Tag: CUL1: Untagged / RBX1: Untagged

Background and Additional Info

Background: Cullin-1 (CUL1) is a central scaffold protein in SCF (SKP1–CUL1–F-box) E3 ubiquitin ligase complexes that control the ubiquitylation and turnover of proteins governing cell-cycle progression, signal transduction, and transcription. Within the SCF complex, CUL1 structurally bridges SKP1–F-box substrate-recognition modules with the RBX1 RING subunit, thereby positioning both the bound substrate and an E2 ubiquitin-conjugating enzyme to promote efficient ubiquitin transfer. Biologically, CUL1 is essential for orderly cell-cycle transitions, maintenance of genomic stability, and proper responses to mitogenic and stress signals, and its dysregulation has been linked to tumorigenesis. In vivo, SCF E3 ligase activity depends on covalent attachment of NEDD8 (neddylation) to the CUL1 subunit, which activates the complex and modulates its interactions.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Frozen Dry Ice
References: Liwocha, J., et al. (2024) Nat Struct Mol Biol 31(2):378-389 PMID: 3832665

Zeng, X., et al. (2025) FASEB J 39(2):e70326. PMID: 3981250

Nguyen, K.M & Businco, L. (2020) Adv Exp Med Biol 1217:111-122 PMID: 31898225

Alternate Names: Cullin-1; CUL-1
Protein Sequence: GSDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA