Ubiquitin, K11R

Ub/Ubl's

Product Code: TUB-093
Verified Applications: Recombinant Ubiquitin is activated for use in vitro by Recombinant Ubiquitin Activating Enzyme 1 (UBA1). This initial event in the ubiquitin-proteasome cascade requires Mg-ATP and ubiquitin. Appropriate protein concentrations are specific to the application.
Activity: Verified in Ubiquitin Charging Assay.
Purity: 95 %
Concentration: 400 μM

For Research Use Only (RUO)

Add to Quote
Predicted Molecular Weight: 8.6 kDa
Tag: Untagged

Background and Additional Info

Background: Ubiquitin is a small regulatory protein that plays critical roles in various cellular processes in eukaryotic organisms. Its primary function is to tag proteins for degradation. This process, known as ubiquitylation, involves the attachment of ubiquitin molecules to substrate proteins, signaling them for destruction by the proteasome. Additionally, ubiquitylation also regulates many other cellular functions, including DNA repair, cell cycle regulation, and response to stress. This recombinant ubiquitin protein contains a K11R mutation.
Shipping: The product is shipped with cold packs or dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Frozen Dry Ice
Protein Sequence: MQIFVKTLTGRTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG