Active, Recombinant Human UBE2G2

E2 Conjugating Enzymes

Product Code: TE2-007
Verified Applications: Recombinant Ubiquitin Conjugating Enzyme E2 G2 accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer ubiquitin to a protein substrate in an E3 Ligase-catalyzed reaction. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in Ubiquitin Charging Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: P60604
Predicted Molecular Weight: 19 kDa
Tag: Untagged

Background and Additional Info

Background: UBE2G2 is a class I ubiquitin‑conjugating (E2) enzyme that plays a central role in ER‑associated degradation (ERAD). UBE2G2 cooperates with specific E3 ligases, notably gp78/AMFR and HRD1, to build K48‑linked polyubiquitin chains on proteins misfolded in the endoplasmic reticulum. These tagged substrates are then retrotranslocated and degraded by the 26S proteasome, maintaining ER protein quality control and limiting ER stress. UBE2G2 is largely cytosolic but functionally enriched at the ER membrane through interactions with E3s and adaptors. It is broadly expressed and partially redundant with UBE2G1, yet UBE2G2 is often the dominant ERAD E2, and its loss causes accumulation of misfolded ER clients and activation of the unfolded protein response.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Smith C.E., et al. (2021) PLoS Biol. 19(12):e3001474. PMID 34879065

Tsai P-L., et al. (2022) Cell Reports 41(8):111675. PMID 36417855

Roussel B.D., et al. (2013) Hum Mol Genet 22(22):4616-4626. PMID 23814041

Alternate Names: Ubc7
Protein Sequence: GPGSMAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL