Active, Recombinant Human UBE2G1

E2 Conjugating Enzymes

Product Code: TE2-006
Verified Applications: Recombinant Ubiquitin Conjugating Enzyme E2 G1 accepts activated ubiquitin from Ubiquitin Activating Enzyme 1 (an E1) in in vitro reactions. This charged E2 may subsequently transfer ubiquitin to a protein substrate in an E3 Ligase-catalyzed reaction. Appropriate enzyme concentrations are specific to the application.
Activity: Verified in Ubiquitin Charging Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
Protein Name: UBE2G1
UniProt #: P62253
Predicted Molecular Weight: 20 kDa
Tag: Untagged

Background and Additional Info

Background: UBE2G1 is a ubiquitin-conjugating enzyme (E2) that collaborates with E3 ligases to transfer ubiquitin to substrate proteins, targeting them for proteasomal degradation. It functions in ER-associated degradation (ERAD), helping clear misfolded membrane and secretory proteins from the endoplasmic reticulum. UBE2G1 pairs with RBR and RING E3s, including components of Cullin-RING ligases, and supports K48-linked polyubiquitin chain elongation. It contributes to protein quality control, stress responses, and cellular proteostasis. Loss or inhibition of UBE2G1 can impair degradation of specific substrates, alter unfolded protein response signaling, and sensitize cells to proteotoxic stress.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Lu G., et al. (2018) eLife 7:e40958. doi: 10.7554/eLife.40958. PMID 30234487

Choi Y-S., et al. (2015) J Biol Chem 290(4): 2251-2263. PMID 25471371

Sievers Q.L., et al. (2009) Blood 132(12): 1293-1303. PMID 30042095

Alternate Names: Ubc7, E2-17K
Protein Sequence: GPGSMTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE