Active, Human Recombinant UBE2M

E2 Conjugating Enzymes

Product Code: TE2-011
Activity: Verified in NEDD8 Charging Assay
Purity: 95%
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
Protein Name: UBE2M
Predicted Molecular Weight: 21 kDa

Background and Additional Info

Background: UBE2M (also called UBC12) is a human E2 ubiquitin-conjugating enzyme specialized for the NEDD8 pathway. It catalyzes transfer of NEDD8, a ubiquitin-like modifier, from the E1 NEDD8-activating enzyme to substrate proteins, primarily cullin family scaffold proteins in Cullin-RING E3 ligases (CRLs). NEDD8 conjugation (neddylation) activates CRLs, promoting ubiquitin-dependent proteasomal degradation of many regulatory proteins involved in cell cycle, DNA repair, and signal transduction. UBE2M works with E3 NEDD8 ligases (e.g., RBX1) and is regulated by expression levels, post-translational modifications, and interactions with deneddylases (e.g., CSN). Dysregulation of UBE2M/neddylation is implicated in cancer and other diseases.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Gong L., & Yeh, E.T. (1999) J Biol Chem 274(17):12036-12042 PMID 10207026

Huang D.T., et al., (2004) 11(10):927-935 PMID 15361859

Alternate Names: Ubc12
Protein Sequence: GPGSMIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK