Recombinant Human NEDD8

Ub/Ubl's

Product Code: TUB-081
Verified Applications: Recombinant NEDD8 is activated for use in vitro by recombinant NEDD8 Activating Enzyme 1. This reaction requires Mg-ATP. Appropriate protein concentrations are specific to the application.
Activity: Verified in NEDD8 Charging Assay.
Purity: 95 %
Concentration: 400 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: Q15843
Predicted Molecular Weight: 8.6 kDa
Tag: Untagged

Background and Additional Info

Background: NEDD8 (neural precursor cell expressed, developmentally down-regulated 8) is a small ubiquitin-like modifier that conjugates to target proteins in a process called NEDDylation. The best-characterized substrates are cullin family proteins, where NEDD8 attachment activates cullin-RING E3 ubiquitin ligases (CRLs), promoting ubiquitin transfer to specific substrates and regulating protein turnover. NEDDylation is reversible: NEDD8 is removed by deneddylases such as the COP9 signalosome and NEDP1, allowing dynamic control. NEDD8 pathway influences cell cycle progression, DNA repair, signal transduction, and development. Dysregulation of NEDDylation is implicated in cancer and neurodegeneration, making the pathway a therapeutic target.
Shipping: The product is shipped with cold packs or dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -20°C (stable for 48 months from date of receipt).
References: Hori T., et al. (1999) Oncogene 18(48):6829-3684. PMID 10597293

Amir R.E., Iwai K., Ciechanover A. (2002) J Biol Chem 277(26):23253-9. PMID 11953428

Walden H., et al. (2003) Mol Cell 12(6):1427-1437. PMID 14690597

Protein Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG