Recombinant TUBE (UBQLN1)

Affinity Matrices

Product Code: TAM-060
Verified Applications: Recovers K48-linked polyubiquitin using anti-His magnetic beads
Activity: Verified in Polyubiquitin Pull-Down Assay.
Purity: 95 %
Concentration: 50 μM

For Research Use Only (RUO)

Add to Quote
UniProt #: Q9UMX0
Predicted Molecular Weight: 21 kDa
Tag: N-6xHis-3C

Background and Additional Info

Background: Each UBA (aa 581–624 of UBQLN1) forms a compact three-helix bundle that docks the Ile44 patch of ubiquitin. Four UBAs are arrayed in tandem via Gly/Ser linkers, yielding a 21 kDa monomer that avidly binds polyubiquitin chains but not mono-ubiquitin. TUBEs do not catalyze ubiquitylation; instead, they act as high-affinity scavengers that (i) sequester polyubiquitin chains immediately upon cell lysis, (ii) protect them from DUB cleavage and proteasomal turnover, and (iii) serve as affinity resins for downstream immunoblotting, pulldown-MS or microarray formats. In live-cell imaging, fluorescent TUBEs act as reporters for stress-induced burst ubiquitylation.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
References: Zhang, D., et al., (2008) J Mol Biol 377:162-180. PMID 18241885

Hjerpe, R., et al., (2009) EMBO Rep 10:1250-8. PMID 19798103

Aillet, F., et al., (2012) Methods Mol Biol 832:173-183. PMID 22350885

Lopitz-Otsoa, F., et al., (2012) Proteomics 75:2998-3014. PMID 22178446

Kadimisetty, K., et al., (2021) Methods Mol Biol 2365:185-202. PMID 34432245

Alternate Names: TUBE2
Protein Sequence: MSHHHHHHGSLEVLFQGPSGCGRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGGSGGSGRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGGSGGSGRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGGSGGSGRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGS