2 μg SENP1 run on 4-12% SDS-PAGE gel under reducing conditions
Active, Human, Recombinant SENP1 (G410-L644)
DUBs
Product Code: TDE-069
Activity: 100 nM SENP1 will cleave 50 μg SUMOylated test protein in 2 hours at 4°C
Purity: 95%
Concentration: 50-60 μM
For Research Use Only (RUO)
Protein Name: SENP1
UniProt #: Q9P0U3
Predicted Molecular Weight: 28 kDa
Background and Additional Info
Background: SENP1 (sentrin/SUMO-specific protease 1) is a cysteine protease that reverses SUMOylation by processing SUMO precursors and deconjugating SUMO from target proteins. Structurally it has an N-terminal regulatory region and a conserved C-terminal catalytic domain. By removing SUMO modifications, SENP1 modulates the activity, stability, and localization of transcription factors, signaling proteins, and DNA-repair factors, thereby influencing cell-cycle progression, apoptosis, and stress responses. SENP1 is upregulated by hypoxia and can enhance hypoxic signaling (for example, via HIF‑1α), and its dysregulation is linked to tumorigenesis and metastasis. In vitro, SENP1 is useful in removing SUMO fusion tags from recombinant proteins, or for de-SUMOylating proteins in lysates.
Shipping: The product is shipped with dry ice. Upon receipt, store it immediately at the temperature recommended below.
Storage and Stability: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Aliquot and store ≤ -70°C (stable for 24 months from date of receipt).
Kim, Y.H., et al. (2005) FEBS Lett 579(27):6272-8627 PMID: 16253240
Protein Sequence: GPGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL